Protein Info for Psest_0741 in Pseudomonas stutzeri RCH2

Annotation: drug resistance transporter, Bcr/CflA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 3 to 382 (380 residues), 309.8 bits, see alignment E=1.8e-96 PF07690: MFS_1" amino acids 14 to 351 (338 residues), 153.9 bits, see alignment E=5.7e-49 PF00083: Sugar_tr" amino acids 41 to 182 (142 residues), 38 bits, see alignment E=9.7e-14

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 96% identity to psa:PST_3610)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ35 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Psest_0741 drug resistance transporter, Bcr/CflA subfamily (Pseudomonas stutzeri RCH2)
MSLRILLILGALSAFGPLAIDMYLPAFPLLAQSFGTSVDHVQLSLAAYFIGLAIGQLVYG
PLADRYGRRGPLLIGVTLFTLASLASAFAPSMDWLIGVRFVQALGGCAGMVVARAVVRDL
CDPMTSAKVFSQLMLVMGLAPILAPVAGGALLASFGWPSIFILLTLFSAMCLVAVTLWLP
ETYPAGLPRQPMSGALGQYLRLFRDRFFIGHVLTGALCMAGMFAYITGSPFVFIELYGVK
PEHFGWLFGINAAGFILMAQVNVRLVRWRGPEFWVRRWVWFFFGSALALLAVAAAQPESL
WPLLIPLFCCVSCLGCLLPNATACAMADQRANAGSASALLGSMQFTIAAIAASAVGALHN
GTAVPLAAIISLCGLLATVVAYTTARASTE