Protein Info for HP15_705 in Marinobacter adhaerens HP15

Annotation: peptidyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 92% identical to PTH_MARHV: Peptidyl-tRNA hydrolase (pth) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 92% identity to maq:Maqu_2367)

MetaCyc: 57% identical to peptidyl-tRNA hydrolase (Escherichia coli K-12 substr. MG1655)
Aminoacyl-tRNA hydrolase. [EC: 3.1.1.29]

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPW8 at UniProt or InterPro

Protein Sequence (195 amino acids)

>HP15_705 peptidyl-tRNA hydrolase (Marinobacter adhaerens HP15)
MAQDIVMVVGLGNPGADYENTRHNAGALFVEALARTAGQTLRPEKKYHGLYARIQWQGLD
LHLLNPTTFMNRSGLAIKALADFFKIQPQQILIAHDELDLPPGTAKLKKGGGHGGHNGLR
DAIAHLGTNDFQRLRIGIGHPGDSRRVTGYVLGRLGKQETEELNAVIDEIMRVLPDAASG
KLPAAMNRLHSFKPV