Protein Info for PGA1_c07370 in Phaeobacter inhibens DSM 17395

Annotation: putative short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF23441: SDR" amino acids 11 to 253 (243 residues), 43.9 bits, see alignment E=5.1e-15 PF08659: KR" amino acids 13 to 175 (163 residues), 52.8 bits, see alignment E=1.2e-17 PF01370: Epimerase" amino acids 15 to 113 (99 residues), 22 bits, see alignment E=2.5e-08 PF00106: adh_short" amino acids 15 to 198 (184 residues), 160.3 bits, see alignment E=1e-50 PF13561: adh_short_C2" amino acids 22 to 252 (231 residues), 193.1 bits, see alignment E=1.4e-60

Best Hits

Swiss-Prot: 51% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 87% identity to sit:TM1040_3488)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX77 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PGA1_c07370 putative short chain dehydrogenase (Phaeobacter inhibens DSM 17395)
MSDTAIFPDLKGASVFITGGGSGIGAALSEGFLRQGAKVAFVGRSDATDFVERMEAETGN
RPLFIQCDITDIPALKAAIKQAAEAHGPITTLVNNAANDQRHATLDVDEEFWDWAQAINL
KAYFFACQAVLPGMQAAGGGSIVNFTSISYMMGNNGYPAYTTANAGINGMTRSLAREFGP
DRIRVNALAPGWVLTDKQLDQWATPEALAAHLERQCLKDHLAPQDIVGSTLFLASATSRM
VTGQTLVVDGGVVVTG