Protein Info for PGA1_c07320 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Inositol transport system ATP-binding protein
Rationale: Specific phenotype on inositol and cofit with other nearby components (SEED_correct)
Original annotation: sugar ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 177 (154 residues), 107.3 bits, see alignment E=9.9e-35

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 89% identity to sit:TM1040_3341)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX72 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PGA1_c07320 Inositol transport system ATP-binding protein (Phaeobacter inhibens DSM 17395)
MSMSQPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPT
KGDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFD
HDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALG
VRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL
QDMMAGGQELATLEGSLGGTV