Protein Info for PGA1_c07310 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Inositol transport system permease protein
Rationale: Specific phenotype on inositol and cofit with other nearby components (SEED_correct)
Original annotation: binding protein dependent transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 302 to 333 (32 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 359 (298 residues), 153.7 bits, see alignment E=2.8e-49

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 84% identity to sit:TM1040_3342)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYD2 at UniProt or InterPro

Protein Sequence (373 amino acids)

>PGA1_c07310 Inositol transport system permease protein (Phaeobacter inhibens DSM 17395)
MSDAPTQFAEDERIKTRSKFREAMIRPELGGIIGTITVFAMFLIFAGDSGMFNSQGVMNW
SQISAQFMIIAVGACLLMIAGEFDLSVGSMIGFAGMLIAIFSVTLGWPVWLAILVTFAIA
TAIGALNGFIVVRTGLPSFIVTLAFLFILRGFAIYLPQTIERKTIIGGVADAAEGDWLAA
LFGGKILTGLFQWFGDNGWIAVFERGTRKGQPVVEGLPMLIVWAILLVIIGHVILTKTRF
GNWIFAAGGDAEAARNSGVPVNRVKILMFMFTAFCATVFATCQVMEFGGAGSDRGLLKEF
EAIIAVVIGGALLTGGYGSVLGAALGALIFGVVQQGLFFAGVESSLFRVFLGLILLFAVI
LNTYIRRVITGER