Protein Info for PGA1_c07290 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, lacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00356: LacI" amino acids 4 to 49 (46 residues), 53.9 bits, see alignment 2.4e-18 PF00532: Peripla_BP_1" amino acids 62 to 294 (233 residues), 69.4 bits, see alignment E=7.7e-23 PF13407: Peripla_BP_4" amino acids 63 to 307 (245 residues), 85.2 bits, see alignment E=1.1e-27 PF13377: Peripla_BP_3" amino acids 170 to 327 (158 residues), 94.3 bits, see alignment E=1.8e-30

Best Hits

KEGG orthology group: None (inferred from 86% identity to sit:TM1040_3344)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUR2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PGA1_c07290 transcriptional regulator, lacI family (Phaeobacter inhibens DSM 17395)
MAVTLKDVAERAQVSRSAVSRTFTDGASVSEKMRRKVEKAAQELGYSPNALASSLTTGRT
KLIGLVSNNFHNPIFLEVFDRFTRRLQDRGLRPLLVNLSDETDPENSVRMLRQYSVDGVV
VASSTLPPGFAKAFRDAGVPVVHSFGRSSSTPQVHVVGIDNVECGRMAARTLVARGYNKV
AFMGGPQSATSTQDRCKGFTSEMEAHPEITATHSFAEDYSFEAGRREMLRLLQDDPAEAY
FCGDDVLSIGALSAIREQGLQVPQDVGVIGLNDMEMARWENIDLTTIHQPIEQIVNSSIE
LVAAMLDEPDRYPEARIFPCHVVERGTLRPQKT