Protein Info for Psest_0726 in Pseudomonas stutzeri RCH2

Annotation: Membrane protein required for beta-lactamase induction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF17113: AmpE" amino acids 5 to 207 (203 residues), 44.2 bits, see alignment E=8.5e-16

Best Hits

KEGG orthology group: K03807, AmpE protein (inferred from 87% identity to psa:PST_3625)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ20 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psest_0726 Membrane protein required for beta-lactamase induction (Pseudomonas stutzeri RCH2)
MSFLVILLVLLVDKFSDWRLRVQHDGPWLARLRQAEGNQRLQRAPWLALLLLVLLPVLLL
GLLLAALEPLAYGWLSLPLHLLVLLYSLGRGHAKSELGAFRDAWRRGDQEAAALAAERDV
GLQEQDPPSLLQAVQTRLLWKSYEGFFAVIFWYLLLGPMAALAYRLLALCAEHASLEGLR
ERAEQLRHAFDWLPVRVLLGSFALVGNFVAVNRALLDELLSWDVPARRLLADAGPLAADL
SPSIDGEAGIARLDGIAALLVRTRVFWYAVIAVLTILA