Protein Info for PGA1_c07270 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Myo-inosose-2 dehydratase (EC 4.2.1.44)
Rationale: Specifically important for utilizing m-Inositol. Automated validation from mutant phenotype: the predicted function (MYO-INOSOSE-2-DEHYDRATASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: putative iolE/mocC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 83% identity to sit:TM1040_3346)

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

myo-inositol degradation I (7/7 steps found)
myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX67 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PGA1_c07270 Myo-inosose-2 dehydratase (EC 4.2.1.44) (Phaeobacter inhibens DSM 17395)
MTIRIGNAPCSWGVEFAQDPRNPDWRSVLKDCAEAGYKGIELGPVGYMPEDPAILRDALA
EYDLELIGGVVFRAFHDPDQWDDVLDGAHRTCKALQAHGAQHLVLIDSISPRRAPTAGRA
SEAEQMNHAEWSAFRDRLATVAQIGTEEYGLTVGIHAHAAGFMDFEPELERLLNEVDDKI
LKICFDTGHHSYAGFDPVAFMKRHMDRISYMHFKDIDPKVKADVIAKRTNFYDACGQGIF
CNLGEGDVDFPAVRQLLVDTGFSGWCTVEQDCDPTLDPDPVGDARANREYLESIGFN