Protein Info for PGA1_c07250 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 9 to 621 (613 residues), 808 bits, see alignment E=3.1e-247 PF02776: TPP_enzyme_N" amino acids 39 to 134 (96 residues), 45.8 bits, see alignment E=7.3e-16 PF00205: TPP_enzyme_M" amino acids 223 to 356 (134 residues), 140.1 bits, see alignment E=5.8e-45 PF02775: TPP_enzyme_C" amino acids 427 to 576 (150 residues), 85.5 bits, see alignment E=5.1e-28

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 81% identity to sit:TM1040_3348)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJT6 at UniProt or InterPro

Protein Sequence (624 amino acids)

>PGA1_c07250 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22) (Phaeobacter inhibens DSM 17395)
MTTPPKTVKLTTAQAIIRWLSNQFIEVDGEELRLCGGGFGIFGHGNVTCLGEALYEARDA
LPLYRGQNEQSMGFAAAGYAKQWLRQRFMFCTASAGPGTSNLLTSAALAHANRLPMLMLC
GDTFLTRLPDPVLQQMENFNDPTFGVNDAFKPVSRYWDRITHPAQIIQSLPAAIATMLDP
GDCGPAFLGLPQDVQGWTYDYPEVFFEKKIHRIRRVTPDASEIAEAAAALRGAKRPMIIA
GGGVQYSRAVAELTAFAETHQIPVVETIAGRANLRDTHPLNIGPIGVTGSDSANAIAAEA
DVILAVGTRLQDFTTGSWTAFAQDAQFISINAARHDAGKHRSLPVVGDAQRALRDLGAAC
EGYSTPQDWVARAQEERHSWVAYVADNVSYGDNRPNSYAQAIGVVNALCNPKDRVVAAAG
GLPAEVTANWRTLEPGTVDVEFGFSCMGYEIAGAWGARIAQAEREPDRDTIVFVGDGSYM
MLNSDIYSSVLSQKKLIILVLDNGGFAVINKLQNNTGNTSFNNLLEDCPTIPEAFGVDFA
SHAASMGALTETVANPAELGEAFKRAQASDRTTVIVMKVDAYEGWTTEGHAWWEVGTPHI
TNDPKVQEAHVDWESSRSRQRRGV