Protein Info for PGA1_c07230 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: putative myo-inositol catabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 12 to 269 (258 residues), 239.3 bits, E=2.5e-75

Best Hits

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 80% identity to sit:TM1040_3350)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

See I7DMV3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PGA1_c07230 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30) (Phaeobacter inhibens DSM 17395)
MHIAPHDNQNKAIVEAENDLVPLNYFNIVKLTKGQTFEYQVPGYETCIVPATGTVDIEVE
GLSYAGVGKRTVDVWDGEPEGVYIPVGAKVTITCTTDATETFIAGAKYDKVLEPFDVRAG
GIDKVQYGSDDTKTHRKIKHILGQKQHDKVGRLLVSELFTVGQGGWSGFPAHKHDTDRKD
ADGNIIETRHDETYNFRFRPNHGSGVQILQREEGKPGDAYQLMDGSTIMIDKGYHPCAVM
PGYEMYYFTILGGLSQRSLIQYFQPTHAYQVETIPGIKDMVAKFK