Protein Info for PGA1_c07210 in Phaeobacter inhibens DSM 17395

Annotation: inositol 2-dehydrogenase IdhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR04380: inositol 2-dehydrogenase" amino acids 1 to 326 (326 residues), 436.8 bits, see alignment E=2.1e-135 PF01408: GFO_IDH_MocA" amino acids 2 to 116 (115 residues), 80.6 bits, see alignment E=3.1e-26 PF03807: F420_oxidored" amino acids 4 to 85 (82 residues), 22.7 bits, see alignment E=2.4e-08 PF22725: GFO_IDH_MocA_C3" amino acids 127 to 248 (122 residues), 98.9 bits, see alignment E=4.5e-32 PF02894: GFO_IDH_MocA_C" amino acids 133 to 328 (196 residues), 96.1 bits, see alignment E=5.6e-31

Best Hits

Swiss-Prot: 55% identical to MI2D_RHIME: Inositol 2-dehydrogenase (idhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 72% identity to sit:TM1040_3352)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYC2 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PGA1_c07210 inositol 2-dehydrogenase IdhA (Phaeobacter inhibens DSM 17395)
MLNIGLLGCGRIGQVHARSVGQLDGVRVTAVADAMPDAANALASKIGADVREASALITSA
DVDAVVIGTPTDTHYDLIHQAAAAGKAIFCEKPVDMSADRIRDCQKVVTEAGVAFLTAFN
RRFDPNFANLQQRLRAGEIGDVEIVSILSRDPSPPPISYIKTSGGLFRDMMIHDFDMARF
LLAEEPVQVFAVGSALVDPAIGAAGDVDTAAVTLTTTSGKICQISNSRRATYGYDQRVEV
HGSKGMLRAANMLENTVEVAGTTGFQTAPAQHFFLERYEAAYRNEMARFVEAVQTGNTPS
PSIDDGLRAQMLADAAAQSLETGAPVAL