Protein Info for PGA1_c07160 in Phaeobacter inhibens DSM 17395

Annotation: FOG: WD40 repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05694: SBP56" amino acids 26 to 428 (403 residues), 153.6 bits, see alignment E=3.8e-49

Best Hits

Swiss-Prot: 89% identical to MTO_RUEPO: Methanethiol oxidase (mtoX) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 89% identity to sil:SPOA0269)

MetaCyc: 57% identical to methanthiol oxidase monomer (Hyphomicrobium sp. VS)
Methanethiol oxidase. [EC: 1.8.3.4]

Predicted SEED Role

"FIG00919017: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYB8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PGA1_c07160 FOG: WD40 repeat (Phaeobacter inhibens DSM 17395)
MNRREFGGLSAAALAMAAPFRAFADETCQSPYMPKITGQEEFVYVWTLGVEGMGDEQDKM
VTVDLRPDSPTRGEVIHSLSVGGRNEAHHGGFSADRRYFWTGGLDTNRIFIFDIHSDPAA
PKLHKVIETFVTDSGGVVGPHTFFALPGSMMITGLSNQDDHGGRTALVEYNDDGDYVATY
WMPTADDMQGAVAVDGAVADGYGYDIRALIRKNVMLTSSFTGWSNYMMDFGQMLQDAEAM
KRFGNSMVLWDLHTRQPRKVFNVPGAPLEVRFPWGPNANYAFSTTALTSQLWLIYEDDDG
EWQAKSVADIGNPEDIPLPVDISIAADDQTLWVNSFMDGKTRLFDISDPHNPAQIYEKTI
DRQVNMVSQSWDGKRVYFSSSLLANWDKKGDDDVQYLRAYNWDGKELVEDFNIDFYAAGL
GRAHIMRFGSAALYSA