Protein Info for Psest_0710 in Pseudomonas stutzeri RCH2

Annotation: uncharacterized protein, YfiH family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF02578: Cu-oxidase_4" amino acids 24 to 242 (219 residues), 238 bits, see alignment E=5e-75 TIGR00726: YfiH family protein" amino acids 29 to 243 (215 residues), 183.2 bits, see alignment E=2.2e-58

Best Hits

Swiss-Prot: 68% identical to POLOX_PSEAE: Polyphenol oxidase (PA4543) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05810, conserved hypothetical protein (inferred from 82% identity to psa:PST_3641)

Predicted SEED Role

"COG1496: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH17 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Psest_0710 uncharacterized protein, YfiH family (Pseudomonas stutzeri RCH2)
MSGWGEDWLVPEWPAPANVRACVTTRRGGVSVAPFDSFNLGDHVGDDPVAVSWNRQHLRD
TLGCEPIWLAQVHSNMAVHAAPGTCVTADASWSETPGQACAVLTADCLPVLFCDRAGTRV
AAAHAGWRGLAGGILEATLEALAIPADQVLVWLGPAIGPAAFEIGPEVREAFLARHPAAA
AAFLPSVNAGRFMADLYQLARLRLAAFGVHAVYGGGLCSFSDARFYSYRRAARTGRFASL
IWLAP