Protein Info for PGA1_c07080 in Phaeobacter inhibens DSM 17395

Annotation: small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 85 to 113 (29 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 102 to 167 (66 residues), 62.5 bits, see alignment E=3.3e-21 PF21082: MS_channel_3rd" amino acids 174 to 256 (83 residues), 49.8 bits, see alignment E=3.8e-17

Best Hits

Swiss-Prot: 40% identical to MSCS_ECO57: Small-conductance mechanosensitive channel (mscS) from Escherichia coli O157:H7

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 80% identity to sit:TM1040_3627)

MetaCyc: 40% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMT9 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PGA1_c07080 small-conductance mechanosensitive channel (Phaeobacter inhibens DSM 17395)
MEQWIEQLGALWPLLISAAKALVVLVVGWIAAGVISGAVRRRINATPHLDQTLGNFAASA
VRWVLLAIVLVAVLGIFGIEATSLVAMLGAATLAIGLALQGTLSDLAAGVMLVMFRPYKL
GQYVDIGGTSGTVVDLNLFVTELVTPDNVQIIIPNGQAWGAIITNYSAHDTRRVDMVFGI
DYGDSADAAKEIILDLANADARVMADPAPWVRVTNLGDSSVDLTARLWCKAADYWELKFA
MTQAVKEAFDDKGISIPYPHSVEIKKEA