Protein Info for PGA1_c07050 in Phaeobacter inhibens DSM 17395

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF13489: Methyltransf_23" amino acids 30 to 193 (164 residues), 57.1 bits, see alignment E=5.6e-19 PF01209: Ubie_methyltran" amino acids 39 to 175 (137 residues), 38.9 bits, see alignment E=1.9e-13 PF13847: Methyltransf_31" amino acids 39 to 142 (104 residues), 48.3 bits, see alignment E=2.8e-16 PF08241: Methyltransf_11" amino acids 44 to 133 (90 residues), 51.1 bits, see alignment E=5.4e-17 PF13649: Methyltransf_25" amino acids 44 to 130 (87 residues), 59.7 bits, see alignment E=1.2e-19 PF08242: Methyltransf_12" amino acids 44 to 130 (87 residues), 55.2 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: None (inferred from 50% identity to sil:SPO3491)

Predicted SEED Role

"methyltransferase, UbiE/COQ5 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJS2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PGA1_c07050 methyltransferase domain-containing protein (Phaeobacter inhibens DSM 17395)
MTADAHFWNRIAPKYAKSKIRDEAAYQYTLERTRSYLTVGDHALEIGCGTGSTAISLSDA
VGRITATDLSDAMLDIGRDRAAEAGADNIGFEQCGDDGLPAGTFDAVMAFNLLHLVPDLD
AALSSVAERLPSGKLFISKTPCLGEARGSFKYWMFLTLIPLMRLVGQAPSNVRFLSVADL
EAAVEQAGFEIIETGNYPASTPGRYLVARRR