Protein Info for HP15_670 in Marinobacter adhaerens HP15

Annotation: peptidase U35, phage prohead

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 PF04586: Peptidase_S78" amino acids 105 to 200 (96 residues), 30.2 bits, see alignment E=4.9e-11 TIGR01554: phage major capsid protein, HK97 family" amino acids 328 to 695 (368 residues), 124.2 bits, see alignment E=3.7e-40 PF05065: Phage_capsid" amino acids 429 to 696 (268 residues), 181.9 bits, see alignment E=1.8e-57

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPT3 at UniProt or InterPro

Protein Sequence (700 amino acids)

>HP15_670 peptidase U35, phage prohead (Marinobacter adhaerens HP15)
MEKQSNRNRQLQPTNQAPEPVAAAPVDKRKALIGSLQTRSVTEEQLRKLKSESLRRDLVV
SEVRALDEQKRTVELAFSSEAEVERWFGIEVLDHSEGAMRTERLEDGAAVLVNHDWNDQV
GVVESVTLGADRKGRAVVRFGRGARASEVWQDIVDGIRRHVSVGYSINKVEVEERSGLAD
MVRVIDWEPHEISIVSVPADVSVGVGRSKEPLPAEGKEADSDTPSKSSAKPNERGSDMEK
ILRDDKGNLVRAKVDDQGKILEVLEVIERAGKAHAEARDAGKQQEQTRVKAIMDMGRQYE
NMDLAGKFVSEGKSPEEFQRALLDEMSQHRSKSLNDQGDQQESRSAQIGLTDKELQRYSM
MKVVRALTNPTDKRAQEEAAFEIELSQEAQRQYGKEARGILVPDDVLSRAFNAGGAADTP
TGAQSGSNIVDTQYMAGSFIDMLRNRTTLMRLATQMTGLVGNVDIPKQTGGATAYWVGEG
VDATEGTPTIGQIGLTPKSVAAFTDITRRLMLQSTPDAEAIVRRDLAAAIALAIDLAGFY
GAGGDEPTGIANVSGINAVDFAGATSGGTGVLPTYSEVVQMESEIAADNADVNSMAYVMN
SGMRGHFKTTEKFSSTNGSPIWEPGNTVNGYRSEVTNQIQAGDLFFGNFADLIIGMWGGL
DLTVDPYSLSKSGGTRLVVFQDVDMAVRRVESFCLGRDST