Protein Info for PGA1_c07010 in Phaeobacter inhibens DSM 17395

Annotation: phenylalanyl-tRNA synthetase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF02912: Phe_tRNA-synt_N" amino acids 17 to 84 (68 residues), 72.4 bits, see alignment E=2.4e-24 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 37 to 340 (304 residues), 329.8 bits, see alignment E=9.5e-103 PF01409: tRNA-synt_2d" amino acids 89 to 340 (252 residues), 322 bits, see alignment E=2.6e-100

Best Hits

Swiss-Prot: 90% identical to SYFA_RUEST: Phenylalanine--tRNA ligase alpha subunit (pheS) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 90% identity to sit:TM1040_2511)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYA5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PGA1_c07010 phenylalanyl-tRNA synthetase alpha chain (Phaeobacter inhibens DSM 17395)
MDDLKAKYLGQIADAADENALEAIRVAAVGKKGEVSLKMRELGKMTPEERQVAGPALNAL
KDEINAALSAKKAGLADAALDARLRTEWLDVTLPTRPMRNGTLHPISQASEELTAIFAEL
GFSVAEGPRIDTDWYNFDALNIPGHHPARAEMDTFYMHRAEGDNRPPHVLRTHTSPVQIR
SMEKMGAPLRIICPGGVYRADYDQTHTPMFHQVEGLALDKDISMANLKWVLEEFVKSYFE
VDSVDLRFRASHFPFTEPSAEVDIRCSWKDGTLKIGEGDDWLEILGSGMVHPKVIAAGGI
DPDVYQGFAFGMGIDRIAMLKYGIPDLRAFFDSDLRWLRHYGFQCLDVPTLHGGLSR