Protein Info for PGA1_c06970 in Phaeobacter inhibens DSM 17395

Annotation: pyruvate kinase PykA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 5 to 322 (318 residues), 364.3 bits, E=5.6e-113
• TIGR01064: pyruvate kinase
  • amino acids 5 to 468 (464 residues), 500.8 bits, E=1.7e-154
• PF02887: PK_C
  • amino acids 355 to 467 (113 residues), 113.4 bits, E=6.4e-37

Best Hits

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 89% identity to sit:TM1040_2516)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• heterolactic fermentation (13/18 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• mixed acid fermentation (11/16 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See I7EX44 at UniProt or InterPro

Protein Sequence (481 amino acids)

>PGA1_c06970 pyruvate kinase PykA (Phaeobacter inhibens DSM 17395)
MRRSRNVKIVATLGPASETYETIRALHEAGADVFRLNMSHGSHEEIAAKHAIIRKVEADL
DSSIAILADLQGPKLRVGVFANGSEELVEGASFRLDLDQAEGDVNRVCLPHPEIFEALQS
GAHLLVNDGKIRLKVETCGSDFANCIVTTGGTISNRKGVNVPDVVLPLAALSEKDRGDLE
FVCGLGVDWLALSFVQRAKDVYEARGLADGRAAVLSKIEKPAAVDNFDEILDASDGIMVA
RGDLGVELPVSAVPPIQKRLVRRCRAAAKPVIVATQMLESMIESPMPTRAEVSDVATAIY
EGADAIMLSAESAAGQYPIEAVQTMDNVATEVEVDPTYVQIIAASRSAKGDTVADAIVAA
AREIAEKTEIKAICCYTQSGTTALLTARERPGVPIIALTPLARTARRLALSWGCNCVVTT
DQDRFKGAVVGAARAARSGGFAGETDQIVVTAGVPFNVPGTTNILRVAPCDERLIYSTDP
E