Protein Info for PGA1_c00700 in Phaeobacter inhibens DSM 17395

Annotation: ATP synthase protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details PF09527: ATPase_gene1" amino acids 39 to 89 (51 residues), 48.4 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 56% identical to ATPZ_RHOCA: ATP synthase protein I (atpI) from Rhodobacter capsulatus

KEGG orthology group: K02116, ATP synthase protein I (inferred from 77% identity to rde:RD1_1321)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL32 at UniProt or InterPro

Protein Sequence (111 amino acids)

>PGA1_c00700 ATP synthase protein I (Phaeobacter inhibens DSM 17395)
MSQEPDKQRLAQLEAKLAEARKAQEPKPRVDEHYSTANQAWRMVIELVAGLMIGFGIGYG
LDLLLGTIPIFLVLFTMLGLAAGVKTMLRSAQEIQEKKLAEMAEQDAQDRD