Protein Info for Psest_0693 in Pseudomonas stutzeri RCH2

Annotation: His Kinase A (phosphoacceptor) domain./PAS fold./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 PF13188: PAS_8" amino acids 7 to 61 (55 residues), 24 bits, see alignment 8.5e-09 PF08448: PAS_4" amino acids 13 to 135 (123 residues), 49.7 bits, see alignment E=1.2e-16 amino acids 177 to 291 (115 residues), 33.4 bits, see alignment E=1.4e-11 PF13426: PAS_9" amino acids 15 to 124 (110 residues), 17.3 bits, see alignment E=1.5e-06 PF02518: HATPase_c" amino acids 446 to 560 (115 residues), 68.2 bits, see alignment E=2.4e-22 PF00072: Response_reg" amino acids 602 to 680 (79 residues), 43 bits, see alignment E=1.4e-14

Best Hits

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIZ6 at UniProt or InterPro

Protein Sequence (720 amino acids)

>Psest_0693 His Kinase A (phosphoacceptor) domain./PAS fold./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Pseudomonas stutzeri RCH2)
MQQRPSFESLFRLSPNAYVLLDRDLVILDANAAYLALTGRKLEDIQGQRLHEAFAADPLS
PEMTRVQELLDSFARVLSRKAVDTLPVIRYSIARQTPLGPIYEDRYWSATHTPILDEQGE
VVAILQHTSDITELQAIKDSVSQAAGGRQPVQQLEQSVMSRAKLLQSEGEQLRRLFAQAP
GFVCFLRGPRHVYELVNDAYRQVIGHRQLLGKTIRDGLPEIEGQVLIGLLDDVYRTGQPY
IGKRVSLFLKRQPEREPEEVILDFVLQPIVENDGKVIGIFVQGQDVTEQQRNEMELRRYR
DHLEELVRERTLALQQSEAERQMTEQALLQAQRLEAVGKLTGGIAHDFNNMLQIIGGNLQ
LLRRSLGSDETAARRLDSAVSGVEKGARLASQLLAFASRQPLLPQQVHLPDLLEQMHELL
NGALGSAVQLELQVLGRPWPVFVDVGNLQSVVLNLAANARDAMSGGGRVVLRLENRLLGA
DVPVGQGGGYVLLSVIDEGSGMTEDVRARAFEPFFTTKQNSNASGLGLSMVYGFVKQSGG
FVTLESGEQGGTAVHVHLPRHVENEPQLPGQGGDGAVESIQDDASRSAPESGADSVDGSL
RILFVEDDPTLRMLTGEVMMELGHEVVASETAEEALEILERQPFDVLLTDVGLAGMSGID
LAREAGTRLPRLSLVIASGYPVNASDVGLDRLRTMLKPYDIHQVRELLDGIRAERAALHI