Protein Info for PGA1_c00690 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details PF00892: EamA" amino acids 8 to 138 (131 residues), 66.4 bits, see alignment E=1.7e-22 amino acids 151 to 283 (133 residues), 62.8 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 68% identity to sit:TM1040_2596)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVJ9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PGA1_c00690 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MALKYWAAIFVLGIGWGMSFMFNAVLLRELGPLSVSMGRVGFGALGCWIYVVAARKQVPD
RPRRWLALFGFGVLSYAAPFAFYALGQQHIASGVAGILNAFTPALAVMVAHFWPGGERAT
LQKSFGVVFGFLGILVLSWLLLQGGRQSEVWAVLVTLCAPLCYAFSVNIARQFRDIDPVV
LVAVALTGATAAITPLAIWAEGLPVITRLETWGALFIIGFILTSAAFILFYWVLPRVGPT
NITLPTLIAPVSALAMGAWVLQEPLKLEHLTGMGLILIGLVLIDGRLLRKIRRRSAL