Protein Info for PGA1_c06810 in Phaeobacter inhibens DSM 17395

Annotation: putative dipeptide transport ATP-binding protein DppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00005: ABC_tran" amino acids 26 to 184 (159 residues), 108.1 bits, see alignment E=5.4e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 234 to 317 (84 residues), 78.4 bits, see alignment E=1.7e-26 PF08352: oligo_HPY" amino acids 236 to 299 (64 residues), 68.4 bits, see alignment E=5.6e-23

Best Hits

Swiss-Prot: 49% identical to OPPD_ECOLI: Oligopeptide transport ATP-binding protein OppD (oppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 79% identity to dsh:Dshi_0884)

MetaCyc: 49% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX29 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PGA1_c06810 putative dipeptide transport ATP-binding protein DppD (Phaeobacter inhibens DSM 17395)
MTDPVLSIRDLVVEIPTRHARLCATDKVSYDIAPGEILGVVGESGAGKSMAGNAVIGLLN
PPARITGGEIRLNGQRIDNLPREKMRRLRGKEIGMIFQDPLTSLNPLLRIGDQLTETMME
HLELTKPEARARAIAALEEVGIPAASERIDSYPHEFSGGMRQRVVIALALCAEPSLIIAD
EPTTALDVSVQAQIIALLKRLCRERGTAVMLITHDMGVIAEAADRVAVMYAGRMAEIGDV
RDVVTRPRHPYTDGLMGSTPSASAGQHRLRQIPGAMPRLHSLPPGCAFSPRCERANERCR
NSPPPTLEADNGRSACWHAIKLEGAA