Protein Info for PGA1_c06800 in Phaeobacter inhibens DSM 17395

Annotation: dipeptide transport system permease protein DppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF12911: OppC_N" amino acids 12 to 49 (38 residues), 35.9 bits, see alignment 5.3e-13 PF00528: BPD_transp_1" amino acids 110 to 304 (195 residues), 100 bits, see alignment E=1.4e-32

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 82% identity to sit:TM1040_3141)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DY88 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PGA1_c06800 dipeptide transport system permease protein DppC (Phaeobacter inhibens DSM 17395)
MQKLKNIWHSDLAWNFRNSPVAVVSALIVLVLALAVILAPLIAPHNPFDPATLNLMNGFS
KPMHPNEFTGEVFLLGTDDQGRDVFSTILYGMRISLMVGVLSVTFAMVLGIILGLLAGYV
GGWTETIIMRVADVQLTFPSILVAMLIFGIVKGVTPVEYRDQMAIWVLILAIGLGEWVQF
ARVVRGATLVEKNREYVQAARLIGRSKWVIMIRHLLPNVLSPVLVIATISLALAIIAEAT
LSFLGVGAPPTQPSLGTLIRIGQGFLFSGEWWILLFPALTLLTLALSVNMLGDWLRDALN
PKLR