Protein Info for Psest_0679 in Pseudomonas stutzeri RCH2

Annotation: ATPase, YjeE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 9 to 138 (130 residues), 162 bits, see alignment E=3.4e-52 PF02367: TsaE" amino acids 10 to 130 (121 residues), 136.7 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 60% identical to TSAE_ECO57: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Escherichia coli O157:H7

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 96% identity to psa:PST_3672)

MetaCyc: 60% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHL8 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psest_0679 ATPase, YjeE family (Pseudomonas stutzeri RCH2)
MPEVNLYAADEAAMLAVGARIAKATGGRGVIYLHGDLGAGKTTLSRGLIRGFGHEGKVKS
PTFTLVEPYELGDVQVFHFDLYRLVDPEELEFLGIRDYFEGNALCLIEWPERGAGILPKA
DMDITIAPHEAGRTLRLSPHTARGEAWCVALTDGEL