Protein Info for PGA1_c06790 in Phaeobacter inhibens DSM 17395

Annotation: putative peptide ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 59.2 bits, see alignment E=4.4e-20 PF00528: BPD_transp_1" amino acids 112 to 319 (208 residues), 122.8 bits, see alignment E=1.5e-39

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 82% identity to sit:TM1040_3142)

MetaCyc: 33% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJQ2 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PGA1_c06790 putative peptide ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MLAYIIRRIMQSVLVLFVVGLVAFSMFRFVGDPIENMLGQERTTEDVVRLRADLGLDQPF
PVQYWRFLENAAQGNFGLSYRQGRPVADILIERAPATLELALVSGTLAMVLGIGLGVLTA
IRRDGWLANTIMTASLIGVSLPTFLIGILLIYVFSVELGWLPSFGRGETVMLGQWSTGFL
TKSGLMSLVLPSITLGLYQMTLIMRLVRSEMLEVLRTDYIRFARARGLGERAVYFRHALV
NTMVPVITIIGLQLGSIIAFAIITETVFQWPGVGLLFINAVQFVDIPVMAAYLMLISVLF
VGINLIVDLLYFLIDPRLRTSKAGAH