Protein Info for Psest_0676 in Pseudomonas stutzeri RCH2

Annotation: ATP-dependent metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 27 to 28 (2 residues), see Phobius details transmembrane" amino acids 12 to 26 (15 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details PF06480: FtsH_ext" amino acids 12 to 97 (86 residues), 42.8 bits, see alignment E=1.5e-14 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 105 to 600 (496 residues), 705.6 bits, see alignment E=1.7e-216 PF06068: TIP49" amino acids 183 to 227 (45 residues), 24 bits, see alignment 6.2e-09 PF00004: AAA" amino acids 193 to 326 (134 residues), 152.4 bits, see alignment E=2.9e-48 PF17862: AAA_lid_3" amino acids 349 to 392 (44 residues), 54 bits, see alignment 2.8e-18 PF01434: Peptidase_M41" amino acids 408 to 600 (193 residues), 216.2 bits, see alignment E=1.2e-67

Best Hits

Swiss-Prot: 68% identical to FTSH_PARP8: ATP-dependent zinc metalloprotease FtsH (ftsH) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 96% identity to psa:PST_3675)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIY1 at UniProt or InterPro

Protein Sequence (615 amino acids)

>Psest_0676 ATP-dependent metalloprotease FtsH (Pseudomonas stutzeri RCH2)
MKDRAQFHMNYWMIAILVFLGLQYLLSIQQEVATIPYSEFEQHLKEGRVEELAITERRIE
GLLKEPLASGQRRFISNRVEPQLAEHLQQYPVRYTGKVESTLVRDLLSWIVPAMLFFGIW
LFLLKRIGSGLGGGGMMQIGKSKARVYVETDMKVSFADVAGVDEAKDELKEIIEFLRDPQ
TYGRLGGRMPKGVLLVGPPGTGKTLLARAVAGEAKVPFFSISGSEFVEMFVGVGAARVRD
LFEQARAQAPAIIFIDELDALGRARGAGPLSGGHDEKEQTLNQLLVEMDGFDTSSGLVLL
AATNRPEILDPALLRAGRFDRQVLVDRPDKVGRVQILNVHLKKSRLGTDVDPQAIAALTP
GFTGADLANLVNEATLLATRRNAEAVAMEDFTAAIERIIAGLEKRNRLLNPREREIVAYH
EMGHALVAMALPGVDPVHKVSIIPRGMGALGYTIQRPIEDRFLMTRDELENKMAVLLGGR
AAEWLVYTHLSTGAADDLAKVTDIARAMVTRYGMSKRLGHLALEREPNSFLGNEAMLGLK
PQHDYAESTATAIDEEVQELVQAAFQRSLELLEARRELLERCARRLLQQETLDAEQLREL
SAAPASVPAQASPQG