Protein Info for Psest_0673 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01225: Mur_ligase" amino acids 2 to 100 (99 residues), 80.6 bits, see alignment E=1.4e-26 TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 448 (447 residues), 709 bits, see alignment E=1.4e-217 PF08245: Mur_ligase_M" amino acids 109 to 291 (183 residues), 71.7 bits, see alignment E=1.2e-23 PF02875: Mur_ligase_C" amino acids 313 to 435 (123 residues), 65.4 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 63% identical to MPL_ECOLI: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Escherichia coli (strain K12)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 95% identity to psa:PST_3678)

MetaCyc: 85% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGX6 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psest_0673  UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (Pseudomonas stutzeri RCH2)
MHIHILGICGTFMGSLAVLAKELGHRVTGSDANVYPPMSTQLQAQGIELTQGYEPSQLEP
APDLVVIGNALSRSNPAVEYVLNKGLPYVSGPQWLADHVLQGRWVLAAAGTHGKTTTSSM
LAWVLEHAGMSPGFLIGGVPQNFGISARLGGTPFFVVEADEYDSAFFDKRSKFVHYRPRT
AILNNLEFDHADIFPDLAAIERQFHHLVRTVPSEGLVIHPESEQALKRVIGMGCWTPVQT
TGDGGQWQAKLLSADGSRFEVIFDGAVQGVVEWELTGQHNVNNALATLAAARHVGVLPKQ
GAEALSEFRSVKRRMEKVAEVNGVTIYDDFAHHPTAIATTLDGLRKRVGDTPIIAVIEPR
SNSMKLGAHREGLAESVALADQAIWYAPANLGWDLAATVAGSPVETTVCDSLEAIIAKVK
ADAVPGTQVVVMSNGGFGGLHGRLAAALS