Protein Info for PGA1_c06670 in Phaeobacter inhibens DSM 17395

Annotation: carbamoyl-phosphate synthase small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 11 to 382 (372 residues), 435.4 bits, E=7.8e-135
• PF00988: CPSase_sm_chain
  • amino acids 13 to 135 (123 residues), 159.5 bits, E=5.3e-51
• PF00117: GATase
  • amino acids 201 to 379 (179 residues), 177.9 bits, E=2.8e-56
• PF07722: Peptidase_C26
  • amino acids 256 to 307 (52 residues), 25.9 bits, 1.2e-09

Best Hits

Swiss-Prot: 86% identical to CARA_RUEPO: Carbamoyl-phosphate synthase small chain (carA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 89% identity to sit:TM1040_2294)

MetaCyc: 52% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (4/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See I7EUL2 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PGA1_c06670 carbamoyl-phosphate synthase small chain (Phaeobacter inhibens DSM 17395)
MADTVTPKPTACLALADGTIFYGNGFGAYGETVAELCFNTAMTGYQEIMTDPSYAGQIVT
FTFPHIGNTGVTPEDDETADPVAAGMVVKWDPTLASNWRATEELKDWLTRTNRIAIGGID
TRRLTRAIRQLGAPHVALAHDPDGNFDIEALVAKAREWSGLEGLDLAKDVTCSQSYRWDE
MRWAWPEGYTRQEAPKHKVVAIDYGAKRNILRCLASAGCDVTVLPASATAEEVLAHSPDG
VFLSNGPGDPAATGEYAVPMIQQILDTTDLPMFGICLGHQMLALALGGKTVKMNHGHHGA
NHPVKENATGKVEITSMNHGFAVDGQSLPDGVEETHVSLFDGSNCGIRISDRPVYSVQHH
PEASPGPQDSFYLFERFAEAMAARKSA