Protein Info for PGA1_c06640 in Phaeobacter inhibens DSM 17395

Annotation: putative pyrimidine 5'-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 11 to 189 (179 residues), 37.8 bits, see alignment E=2.1e-13 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 11 to 188 (178 residues), 195.3 bits, see alignment E=8e-62 PF00702: Hydrolase" amino acids 13 to 180 (168 residues), 41.2 bits, see alignment E=2.6e-14 PF13419: HAD_2" amino acids 13 to 189 (177 residues), 33.8 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 73% identity to sit:TM1040_2297)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DY75 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PGA1_c06640 putative pyrimidine 5'-nucleotidase (Phaeobacter inhibens DSM 17395)
MVSQSFSHVRHWVFDLDNTLYHPSARLFDQIEVKMTDYVMAALGVDQKMANKLRDDYWRE
HGTTLAGLMAHHDLDPDPFLLEVHDINFDQLEPDILLAERIRTLPGKRIIYTNGTAPYAE
QVLAARGLEGCFDEIYGVEHANYRPKPERQAFDIVFAKADIDTAKAAMFEDDPRNLQAPH
DLGMRTVHVAPEATAGAHIHHHTDDLTRFLGLL