Protein Info for Psest_0658 in Pseudomonas stutzeri RCH2

Annotation: Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF01740: STAS" amino acids 10 to 99 (90 residues), 38.9 bits, see alignment E=6.2e-14 PF13466: STAS_2" amino acids 15 to 96 (82 residues), 54.8 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: None (inferred from 36% identity to aaa:Acav_3453)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGW3 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Psest_0658 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) (Pseudomonas stutzeri RCH2)
MFTLQQQASAVGTCLALSGNLTIYEVRDARDALLGAFGAQPSGHWQLDLSALDELDTAGA
QLLLAAQRQLRLSDATLEVCNPSAEALELLQLLRVQTLFSSHAPAASGGRHAQ