Protein Info for PGA1_c06570 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 278 to 294 (17 residues), see Phobius details PF00892: EamA" amino acids 14 to 147 (134 residues), 67.3 bits, see alignment E=1.8e-22 amino acids 165 to 294 (130 residues), 58.5 bits, see alignment E=9.2e-20

Best Hits

KEGG orthology group: None (inferred from 51% identity to apb:SAR116_1368)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUK5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PGA1_c06570 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MSDSPGGANWAKLLFLGVIWGASFMAVSLALRGFPPMTIAALRILIGALCLLAVIRVMGI
QLPTLRTHDGRIIWACAFGMGFFSNALPFTLLSWGQTYVASGFAGVCMAVVPLFVLPLAH
LLVPGEHMTLRRTISFLIGFAGVVVLIGLDAFRSAGTDFESLARLACLGAALCYAIGSII
TRLCPKVNMLSLSAAALLCGAAMMTPAALWAEGMPELPAMQPLAAVIYLGLLPTALAQVL
LVQVARSAGPAFLSTVNYQVPVWSVIFGAALLGETLPPQLFAALALILGGLLLSRRRRPR
TACP