Protein Info for PGA1_c06560 in Phaeobacter inhibens DSM 17395

Annotation: Permeases of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF00892: EamA" amino acids 10 to 141 (132 residues), 75.6 bits, see alignment E=4.9e-25 amino acids 160 to 287 (128 residues), 57.2 bits, see alignment E=2.3e-19 PF06027: SLC35F" amino acids 104 to 287 (184 residues), 22.7 bits, see alignment E=6.5e-09

Best Hits

KEGG orthology group: None (inferred from 65% identity to sit:TM1040_2304)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMP4 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PGA1_c06560 Permeases of the drug/metabolite transporter (DMT) superfamily (Phaeobacter inhibens DSM 17395)
MPNIAPRYWLMIAILGFVWGGTFLLIKLALEGTTPFWLAASRIGFAALLLSAIWGARGFK
LFKDQTNWPSLTLIGILSTALPFMLISWGQQHVSSGFTGVSMAAIPLMVLPLAHVFIPGE
QMTLRRVIGFAIGFAGVAVLLGSTAFESSGAALEGYGRAACLTAAACYSVSSILTRRLPP
VDPLGLAAILLLIGSALIIPVAWLTEGPPVIPDTRTLCIAAVLGLIPTAAANLLRAIVVR
EAGPTFMTLTNYQVPVWAVVLGAFFLGEDLPPAMLMALLLILSGLCISQFGALTRLFGRT
KK