Protein Info for Psest_0650 in Pseudomonas stutzeri RCH2

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 164 (155 residues), 85.6 bits, see alignment E=1.5e-28 PF04542: Sigma70_r2" amino acids 15 to 79 (65 residues), 50.8 bits, see alignment E=2.8e-17 PF07638: Sigma70_ECF" amino acids 39 to 164 (126 residues), 40.6 bits, see alignment E=6.5e-14 PF08281: Sigma70_r4_2" amino acids 110 to 162 (53 residues), 65.5 bits, see alignment E=6.9e-22 PF04545: Sigma70_r4" amino acids 116 to 162 (47 residues), 42 bits, see alignment E=1.3e-14 PF13412: HTH_24" amino acids 134 to 157 (24 residues), 22.4 bits, see alignment 1.8e-08

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 46% identity to avn:Avin_03870)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiD (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GES9 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Psest_0650 RNA polymerase sigma factor, sigma-70 family (Pseudomonas stutzeri RCH2)
MRDNNKIPEACLQCYIHHRQQLVAHLTRLGGCRALAEDLAQDAWLKLAQIMPEQRLDNPK
AYLFRIATNLLRDAMRRRALLGASDEGPLELIEAVQADPCALVENHCALQCVLRQLADLP
PRCREVFELARLEGLSQAEIAERLGISVNTVIAQLAKARQRLERP