Protein Info for PGA1_c06490 in Phaeobacter inhibens DSM 17395

Annotation: sodium/glutamate symport carrier protein GltS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 309 to 334 (26 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details PF03616: Glt_symporter" amino acids 12 to 372 (361 residues), 343.6 bits, see alignment E=5.7e-107 TIGR00210: sodium/glutamate symporter" amino acids 15 to 401 (387 residues), 396.7 bits, see alignment E=4.8e-123

Best Hits

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 68% identity to sil:SPO1357)

Predicted SEED Role

"Sodium/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DY63 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PGA1_c06490 sodium/glutamate symport carrier protein GltS (Phaeobacter inhibens DSM 17395)
MDAQINIPDFISLTLGFAVYLLGARLNERVPVLRRFNIPEPVSGGLLAAVVVMIIYSVGG
WAITFEMATRDYLLVLFFAGIGLNARLADLVAGGRPLVLLLILTFLAILAQNVIGAAGAL
LFGYPLQVSVLFGSAALIGGHGTAIAWAPDVAAQTGLTGAAELGVAVATLGLVLAALVGG
PVARFLINRHGLTPARPDEEPTVGLAHDAEDVPAIDHLSLMRVMLHLNVAIIIGYFSSFA
LDAAGLKLPLFVPCLIAGIVLANLRMGVMPNAAPVARTPALALISEFSLGAFLAMSLMSL
QLWTLSSLGLAIAVIMLAQTVFTVAFVLFVLFPFLGRGYRAAVLAAGFGGFALGATPTAI
ANMTAVTKRYGPSPIAFVVLPLVSAFFVDIANAIVIQAIVNF