Protein Info for Psest_0648 in Pseudomonas stutzeri RCH2

Annotation: Lysine/ornithine N-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF13434: Lys_Orn_oxgnase" amino acids 4 to 339 (336 residues), 434.1 bits, see alignment E=1.8e-134

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_3699)

MetaCyc: 58% identical to putrescine N-hydroxylase (Shewanella sp. MR-7)
1.14.13.M63 [EC: 1.14.13.M63]

Predicted SEED Role

"Siderophore biosynthesis protein, monooxygenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGV2 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Psest_0648 Lysine/ornithine N-monooxygenase (Pseudomonas stutzeri RCH2)
MSKLYDFIGIGIGPFNLGLACLAEPIDGLDCLFLDRAEGFNWHPGMMLDSATLQTPFMAD
LVTLADPTSRFSFLNYAKQVGRLYAFYIKEDFFLMRREYNQYCQWVVEQLDSLRFEHFVQ
QVDYLDERRCYRVRGVHTRSGEGFEFLTRRLVLGTGTTPYLPTCCEALAEHVSHSGNYLQ
DKPRLQGKRSITVVGSGQSAAEIYYDLLQEIDRHDYQLNWITRAPRFFPLEYTKLTLEMT
SPEYIDYFHSLPRSTREKLIDSQKGLYKGINATLINAIYDELYNQSLKGEVPTQLLTNAE
LRRCQRLGDGTLELEFFQHELEQSYRHRCDALVMASGYQYRLPRCIQPIAERIAWQAPER
FAVARNYSIDRNGGEVFVQNAGLVDHGLVTPDLGMGCYRNACILREICGREHYAVETKIA
FQQFSLPQPVTPQGAVAAR