Protein Info for PGA1_c06300 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 196 to 216 (21 residues), see Phobius details PF02104: SURF1" amino acids 16 to 205 (190 residues), 143.4 bits, see alignment E=6e-46

Best Hits

KEGG orthology group: None (inferred from 65% identity to sit:TM1040_2331)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWY6 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PGA1_c06300 Uncharacterized conserved protein (Phaeobacter inhibens DSM 17395)
MRRLIFLSLVGGLGLAALMALGIWQIQRLAWKEDLLRTIEARIAAAPVALPEAPTQAQDR
YRAVSVTGEVEAAELHVFWVTKTAETGYRIIAPLLTEDGRRVLLDRGFVPAAAKDGDRAT
GATSIIGNLLWPDEGDWTTPSPEVDTNILYARDVAYMAERLGTEPVLVVARSASGDADVT
PQPVTTAGIQNNHLQYAITWFSLALIWAAMTTYFLWRSRPKSEG