Protein Info for PGA1_c06290 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details PF00510: COX3" amino acids 7 to 265 (259 residues), 261.7 bits, see alignment E=4.9e-82

Best Hits

Swiss-Prot: 46% identical to COX3_CHICK: Cytochrome c oxidase subunit 3 (MT-CO3) from Gallus gallus

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 84% identity to sit:TM1040_2332)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DY46 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PGA1_c06290 cytochrome c oxidase subunit 3 (Phaeobacter inhibens DSM 17395)
MAHAKNHDYHILPPSIWPLLSSLGTFIMLFGAVLWMHGITAYAFWGGFIMVVYSAYAWWA
EVVAEARQGDHTPVVRIGLRYGFILFVMSEVMFFFAWFWSFFKHAIYPMETYIGTEYVAP
SIYPVDAFHLPLINTLVLLLSGCAVTWAHHALVHNNDRKALIQGLSIGIVLGVFFTFLQG
YEYVHLLHEGWEFGGDEFYSNFFMATGFHGFHVIIGTIFLTVCLIRAMKGDFTPEQHVGF
EAAAWYWHFVDVVWLFLFVAVYVWGTAGLAH