Protein Info for HP15_598 in Marinobacter adhaerens HP15

Annotation: phosphoesterase, PA-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 20 to 52 (33 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details amino acids 451 to 470 (20 residues), see Phobius details PF09335: VTT_dom" amino acids 40 to 163 (124 residues), 53.9 bits, see alignment E=2.7e-18 PF01569: PAP2" amino acids 326 to 438 (113 residues), 57.8 bits, see alignment E=9.7e-20

Best Hits

KEGG orthology group: None (inferred from 61% identity to maq:Maqu_2420)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP50 at UniProt or InterPro

Protein Sequence (485 amino acids)

>HP15_598 phosphoesterase, PA-phosphatase (Marinobacter adhaerens HP15)
MSSAWLNDLSAWLSLHPGWLATALFSTAFIESLAIAGIIVPGVAILFAVAVLAGETGMPL
AEALLWAGLGAIAGDTASFGLGRLLQGRLTTAWPLSRYPKIIGTGERFFKRHGGKSVIIG
RFVGPVRPIIPLVAGALMMSWRRFLAFNIGSAVAWAPVYIFPGFLVGSALASDIRPPAHF
YAVIGISLAALTVVYFVLLRFQLGLGEDSRFYRWLKQWMAQYEATNRFWRLYTNQRPARE
GEFPLASFMLALGASALLLIWGQLATATSLLDGFDQATLLWFEQLRQPLLDGPFIAITLL
GDAPVLMTAGVLACAALLFRGYYAAAIHVLAAIAVTVVLVWGLKAMLGVPRPDEVMGPPN
SGAFPSGHTAGITLLVTLLASFVAGESRHRRRWQYYVLLSLPLVPVALSRLYLGVHWFTD
VIGGLLLALAVTGAVRASYSRYDKVPLAPDITIVGAAVVWLILTGAYILLSWDQAVLNFR
PVAGT