Protein Info for PGA1_c06280 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c oxidase assembly protein CtaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04442: CtaG_Cox11" amino acids 27 to 172 (146 residues), 194.8 bits, see alignment E=4.1e-62

Best Hits

Swiss-Prot: 84% identical to COXZ_RUEPO: Cytochrome c oxidase assembly protein CtaG (ctaG) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 85% identity to sit:TM1040_2333)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJL5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>PGA1_c06280 cytochrome c oxidase assembly protein CtaG (Phaeobacter inhibens DSM 17395)
MALQGPQKTVVQLVGVVVLMGGLAWASVPFYDWFCRVTGFGGVTGVAEQGSDTVLNQTIT
VRFDASKERDMPWQFTPVEREMEIKIGETGLAFYEAYNPTDRPVAGQASYNVTPYSAGAF
FEKIACFCFEEQVLQPGERVEMPVTFFVDPEIVEDRDGKYVHTITLSYTFYEIDLPEGYA
ALETGDTAGAGTNTN