Protein Info for PGA1_c00630 in Phaeobacter inhibens DSM 17395

Annotation: signal recognition particle protein Ffh

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR00959: signal recognition particle protein" amino acids 2 to 430 (429 residues), 572.8 bits, see alignment E=2.1e-176 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 72.3 bits, see alignment E=6.1e-24 PF00448: SRP54" amino acids 103 to 297 (195 residues), 227 bits, see alignment E=3.5e-71 PF01656: CbiA" amino acids 111 to 256 (146 residues), 28.2 bits, see alignment E=3.3e-10 PF02978: SRP_SPB" amino acids 310 to 445 (136 residues), 132.5 bits, see alignment E=2.4e-42

Best Hits

Swiss-Prot: 49% identical to SRP54_HAEIN: Signal recognition particle protein (ffh) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 92% identity to sit:TM1040_2603)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWK0 at UniProt or InterPro

Protein Sequence (507 amino acids)

>PGA1_c00630 signal recognition particle protein Ffh (Phaeobacter inhibens DSM 17395)
MFENLSERLSGVFDRLTKQGALSEEDVKTALREVRVALLEADVSLPVARDFVKRVQEQAT
GQAVTKSVTPGQQVVKIVHDALVDVLRGAEDPGQLKVDNPPAPILMVGLQGSGKTTTTGK
LAKRLKDKEGKRVLMASLDVYRPAAMDQLAVLGTQIGVDTLPIVPGQKPVDIAKRAKQQA
ALGGYDVYMLDTAGRLQIDEVLMQEVEDVRDVVSPRETLLVVDGLTGQVAVEVAEEFDAK
IGISGVVLTRMDGDGRGGAALSMRAVTGKPIRFVGLGEKMDAIETFEPDRIAGRILGMGD
IVALVEKAQETIEAEQAERMMKRMMKGHFNMNDLKMQLEQMIQMGGMQGMMQMMPGMAKM
AKQVEESGFDDKVLRQQIAMIQSMTKKERANPALLQASRKKRIAAGSGMQVSDLNKLMKM
HRQMADVMKKMGKMGKGKMLKQAMSGMFGKGGGMPDMAGMDPSQMDPKALEAAAKAMGGG
KGLAGGLPGLGGMGGLPGGLSGFGKKK