Protein Info for Psest_0619 in Pseudomonas stutzeri RCH2

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 287 (273 residues), 258.6 bits, see alignment E=3.4e-81 PF01545: Cation_efflux" amino acids 17 to 208 (192 residues), 158.6 bits, see alignment E=9e-51

Best Hits

Swiss-Prot: 40% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 91% identity to psa:PST_3428)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIS8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psest_0619 cation diffusion facilitator family transporter (Pseudomonas stutzeri RCH2)
MAHEHNHNTEAIGDKRLIAAIGVNTVLTLAQVVGGILSGSLSLIADALHNLSDAASLVIA
LIARKIGRKPPDAFKTFGYRRSETIAALINLVTLIIVGLYLIYEAIGRFFAPQPIEGWTV
VVVAGIALIVDVVTALLTYTMSKNSMNIKAAFLHNVSDALASVGVIIAGTLILLYDWYWT
DTVLTLMIAGYVLWQGFSMLPKTIHLLMEGAPEGVSITDIINVMEQVDDVVSVHHVHVWE
IAEHSTALEAHVVIKKASLPEIERVKTDLKRVLHERFKVSHSTLEMELDGSVCIDTRQAD
SHRSEA