Protein Info for PGA1_c06070 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13432: TPR_16" amino acids 52 to 94 (43 residues), 16.7 bits, see alignment 3e-06 amino acids 178 to 223 (46 residues), 17.5 bits, see alignment 1.7e-06

Best Hits

KEGG orthology group: None (inferred from 77% identity to sit:TM1040_2353)

Predicted SEED Role

"Flp pilus assembly protein TadD, contains TPR repeat" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUG2 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PGA1_c06070 hypothetical protein (Phaeobacter inhibens DSM 17395)
MRQQIFVSACLVGGLVLSACAKDDTEAVDRAFQEVNVVDESNLNDVMLTVADPNEAVTYF
QRTVKSAPDRIDLNRGLALSLIRAKRNTEAVTAWKKVVSLPEATDADRVELADALIRTSN
WDEAKATLDKVPPTHETFKRYRLEAMVADSEQNWKRSDSFYQTAVGLTTQPARVMNNWGY
SKLTRGDYAEAERLFGDAIRQDQSLFTAKNNLVLARGAQRNYTLPVIPMDQSERAQLLHT
LALSAVKQGDVQTGESLLRQAISTHPQHFDAAARALAALENG