Protein Info for PGA1_c06030 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): DNA repair nuclease, ligase-associated (TIGR04123)
Rationale: Very important for resisting cisplatin. This family was previously annotated as a DNA ligase-associated metallophosphoesterase (TIGR04123). A member of this family (PdeM) has been studied biochemically and found to have nuclease activity, but it was not known if DNA was the physiological substrate (see PMC4320098).
Original annotation: Predicted ICC-like phosphoesterases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR04123: metallophosphoesterase, DNA ligase-associated" amino acids 7 to 199 (193 residues), 193.7 bits, see alignment E=1.3e-61 PF00149: Metallophos" amino acids 29 to 123 (95 residues), 30.1 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: K06953, (no description) (inferred from 59% identity to sil:SPO3099)

Predicted SEED Role

"FIG006285: ICC-like protein phosphoesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJJ8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PGA1_c06030 DNA repair  nuclease, ligase-associated (TIGR04123) (Phaeobacter inhibens DSM 17395)
MTGYDFSLAGQQLTALGSGALWWQARGLLCVADLHLGKSERQLRRGGTALPPYETRDTLE
RLAAVIDQTRPETVICLGDSFDDNAATAALSDADQTRVDQLITAHRWIWITGNHDPAPTG
LAGEAHDSLPLGPLLFRHIADPAFTSESATDVTAEISGHYHPKARLRGNARPAFLADHQR
LILPAFGTYTGGLCTTHDALRDLMSPRALAILTGPRPLPCPMPR