Protein Info for PGA1_c05950 in Phaeobacter inhibens DSM 17395

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02795: tol-pal system protein YbgF" amino acids 157 to 272 (116 residues), 95.7 bits, see alignment E=1.4e-31 PF13174: TPR_6" amino acids 233 to 262 (30 residues), 18 bits, see alignment (E = 1.8e-07)

Best Hits

KEGG orthology group: None (inferred from 65% identity to sit:TM1040_2363)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWV6 at UniProt or InterPro

Protein Sequence (280 amino acids)

>PGA1_c05950 tol-pal system protein YbgF (Phaeobacter inhibens DSM 17395)
MQLRPFAIAALALTLAMPPLMARAQDEQTLADIRQELTVLHVEIQRLKREMSTTGSPQTN
VAGDSVLDRVSAIEAELQRLTAQTEQLSYRVDRVVQDGTNRIGDLEFRLVELEGGDISQL
GETTTLGGGELPEGGAPALPATPGTAVDTTSELAVGEQADFDAAKAALDSGAYQEAAEKF
AAFTQAYPGSPLAAAVEYNRGKALDGLGDTREAARAYLASFSGNATGETAPKALFELGAA
LGRLGQTSQACVTLAEVGSRFPGVAETAAAEAERAKLACN