Protein Info for PGA1_c05930 in Phaeobacter inhibens DSM 17395

Annotation: putative protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 18 to 433 (416 residues), 432.7 bits, see alignment E=7.5e-134 PF04052: TolB_N" amino acids 24 to 130 (107 residues), 98.6 bits, see alignment E=5.6e-32 PF07676: PD40" amino acids 198 to 231 (34 residues), 23.4 bits, see alignment 1.1e-08 amino acids 249 to 275 (27 residues), 23.7 bits, see alignment (E = 9.6e-09) amino acids 284 to 320 (37 residues), 50.6 bits, see alignment 3.2e-17 amino acids 372 to 409 (38 residues), 29 bits, see alignment 2e-10

Best Hits

Swiss-Prot: 81% identical to TOLB_RUEST: Tol-Pal system protein TolB (tolB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03641, TolB protein (inferred from 81% identity to sit:TM1040_2365)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJJ2 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PGA1_c05930 putative protein TolB (Phaeobacter inhibens DSM 17395)
MGATLLGAAVMTSALPAQAQDGPLRIEITDGVIEPLPYAVPGFVPETPAAAELARDISRV
IAADLSGTGLFREVPASAHISKVTDFDAAVSYADWKAVNAQALITGALSVNGNRLTVRFR
GHDVFAEKELGTGLQFSGTTDGWRRMAHKVADVIYSRITGESGYFDSRVVFVSESGPKND
RRKRLAIMDYDGANVQYLTNSASIVLAPRFSPTGDRVLYTSYESGFPQIHVLDVGSVQRR
VLSADNGIMSFAPRFAPDGRTVVYSQSQGGNTDIFTMNIDTGARTRLTSAPSIETAPSFS
PDGSQIVFESDRSGAPQLYVMAATGGEARRISFGAGRYGTPVWSPRGDMIAFTKQNKGRF
HIGVMRTDGSEERLLTASFLDEGPTWSPNGRVIMFTRETQGASGRALLYSVDVSGRNLKP
VRTPDGASDPAWSPLQN