Protein Info for PGA1_c05910 in Phaeobacter inhibens DSM 17395

Annotation: putative biopolymer transport protein ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details PF02472: ExbD" amino acids 23 to 146 (124 residues), 99.6 bits, see alignment E=7.5e-33 TIGR02801: protein TolR" amino acids 25 to 146 (122 residues), 134.2 bits, see alignment E=2.1e-43

Best Hits

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 83% identity to sil:SPO3111)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMJ9 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PGA1_c05910 putative biopolymer transport protein ExbD (Phaeobacter inhibens DSM 17395)
MGASVQPNAANGRRRGRRRSRARPMAEINVTPFVDVMLVLLIIFMVAAPLMTVGVPVELP
KTAAGALPGDEEEPLTVTMTASGEIQIQTTAVAPDELIAKLRAIAAERSSDQVFLRADGA
IPYEAVMQVMGALNAGGFSSVGLVTDVGGPRLDGRAVDDTGQ