Protein Info for HP15_560 in Marinobacter adhaerens HP15

Annotation: UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanyl ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01225: Mur_ligase" amino acids 29 to 98 (70 residues), 31.9 bits, see alignment E=2.1e-11 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 33 to 449 (417 residues), 424.8 bits, see alignment E=1.8e-131 PF08245: Mur_ligase_M" amino acids 110 to 298 (189 residues), 154.1 bits, see alignment E=7.5e-49 PF02875: Mur_ligase_C" amino acids 321 to 440 (120 residues), 62.7 bits, see alignment E=9.6e-21

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 48% identity to pfo:Pfl01_4677)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP12 at UniProt or InterPro

Protein Sequence (462 amino acids)

>HP15_560 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanyl ligase (Marinobacter adhaerens HP15)
MMRAFSLAEAKGWLGAQCASGDLASVSFAGVSTDTRTLEPGQLFVALRGENFDGHRFLQQ
AMDKGAVGLVVDTPDTNLALPQLVVNETLEALARLAAANREESTAAILAITGSSGKTTVK
EMCAAILSQMGKTLSTKGNLNNHIGVPLTLFGLSPEHQYGVIELGASGLGEIAHTVALAK
PRVAILTNAGEAHLEGFGSYENIVLAKGEIIDGVASDGLMVLNGDDPAFAQWRSRAGARR
VAGVSRLGAEADYHAVIDGQDAGTRTFQVSGPDGWLCRVTLGLEGDHNITNMLLAIAATR
ELGASDQAIVAGLASVAPVKGRLQVLELSPEMTLIDDSYNANPSSMKAALGVLAGRAGQK
IAVLGAMAELGAKANALHREVGVCAREHGIDRLITVGPGCEGYADGFGESTELGLSHEQA
VESAIGDKNTPLTVLVKGSRSSAMERVVEGIKEKVNNSCCSG