Protein Info for PGA1_c00570 in Phaeobacter inhibens DSM 17395

Annotation: 30S ribosomal protein S16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 TIGR00002: ribosomal protein bS16" amino acids 3 to 82 (80 residues), 112.2 bits, see alignment E=4.6e-37 PF00886: Ribosomal_S16" amino acids 9 to 70 (62 residues), 103.1 bits, see alignment E=3e-34

Best Hits

Swiss-Prot: 91% identical to RS16_ROSDO: 30S ribosomal protein S16 (rpsP) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 91% identity to rde:RD1_1311)

Predicted SEED Role

"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWJ4 at UniProt or InterPro

Protein Sequence (119 amino acids)

>PGA1_c00570 30S ribosomal protein S16 (Phaeobacter inhibens DSM 17395)
MAMKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDMERVQ
HWLDQGAQPTDRIARMLEAAGVRAKVERNNPKKGTPGKKAQERAEEKAAKAAEATADAE