Protein Info for Psest_0561 in Pseudomonas stutzeri RCH2

Annotation: Urease accessory protein UreH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF01774: UreD" amino acids 55 to 246 (192 residues), 194.6 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 88% identical to URED_PSEU5: Urease accessory protein UreD (ureD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03190, urease accessory protein (inferred from 82% identity to pfo:Pfl01_0585)

Predicted SEED Role

"Urease accessory protein UreD" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEK9 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Psest_0561 Urease accessory protein UreH (Pseudomonas stutzeri RCH2)
MTVLTQLFTPHWHAELELGYALCAGATRPVLRRHSGPLRVQKHLYPEGPEVCQHIIVHPP
GGIAGGDRLDICASVGAGAWAQLTSPGAAKWYRAAGPAYQDLRLRVEAGATLEWLPQETI
VYSAAQAELSTVIELEGDARLFYWDMVALGRPAAGERFDAGHFQARLDIRRDGQLLWHER
QRIAGGDGLLDSPIGLDGRSVFATLIVSGEIYADLMERCRDLPSRVRGDLTQLPGLVVAR
CLADEALHARAWLIDLWRLLRPELLGREAVPPRIWST