Protein Info for Psest_0559 in Pseudomonas stutzeri RCH2

Annotation: Sortase and related acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 21 to 155 (135 residues), 45.3 bits, E=4.3e-15
• PF13420: Acetyltransf_4
  • amino acids 21 to 176 (156 residues), 58.7 bits, E=2.2e-19
• PF00583: Acetyltransf_1
  • amino acids 35 to 155 (121 residues), 73.1 bits, E=7.2e-24
• PF13673: Acetyltransf_10
  • amino acids 63 to 164 (102 residues), 36.4 bits, E=1.4e-12
• PF13508: Acetyltransf_7
  • amino acids 70 to 156 (87 residues), 47.7 bits, E=5e-16
• PF08445: FR47
  • amino acids 103 to 158 (56 residues), 35.5 bits, E=2.4e-12

Best Hits

Swiss-Prot: 61% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 65% identity to pfo:Pfl01_0583)

MetaCyc: 61% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (4/25 steps found)
• phosphinothricin tripeptide biosynthesis (4/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See L0GGN0 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Psest_0559 Sortase and related acyltransferases (Pseudomonas stutzeri RCH2)
MSVNVYCEDPRPALKELNVQIRDALDADLEGILHIYNDAVLNSTAIWNDHTVDLDNRRAW
LAERHAQHYPVLVAIDEQGRVAGYASFGPWRPHDGFRHTVENSVYVSPDHRGSGIGRSLM
KALIERARVLEKHVMVAFIESENRASVHMHQQLGFIHVGQMRQVGCKFGRWLDLTMMQLT
LNRTSNP